PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G13020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 336aa    MW: 35261.3 Da    PI: 8.0343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G13020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.9e-164287147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  LPERR08G13020.1 42 RGHWRPAEDAKLRELVALYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 87
                     899*****************************.***********996 PP

2Myb_DNA-binding52.21.4e-1695137246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++++eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  LPERR08G13020.1  95 RPFSEEEEERLMAAHRYYGNK-WAMIARLFP-GRTDNAVKNHWHV 137
                      68*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7733688IPR017930Myb domain
SMARTSM007176.1E-144190IPR001005SANT/Myb domain
SuperFamilySSF466893.22E-2842135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-264395IPR009057Homeodomain-like
CDDcd001673.37E-134586No hitNo description
PfamPF139217.0E-1645105No hitNo description
PROSITE profilePS5129425.51689143IPR017930Myb domain
SMARTSM007172.2E-1293141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2096142IPR009057Homeodomain-like
CDDcd001671.39E-1096136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDTGIDGGCG GAGYNYNNGG NGGEHQQESS SSGQTSPRLA ARGHWRPAED AKLRELVALY  60
GPQNWNLIAE KLDGRSGKSC RLRWFNQLDP RISKRPFSEE EEERLMAAHR YYGNKWAMIA  120
RLFPGRTDNA VKNHWHVIMA RKYREQSTAY RRRKLNQAVQ RKLDSSSSST VALAAGDGHL  180
VAGDPYAAAA AAAFSFRHYC GFPFPAIAAG DEAHFGCLFP GPAAAGRGVA GGMTWPDAMA  240
AGGGGGGLID GGGGRYVVAE PPPFLFPAAA AHGGAAGWLN HGHEMMMVNG GDVIVSGAGV  300
PYVDGIGRDQ NGGGGGSHFE AAASPAFIDF LGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-34421427107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126164e-98CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649302.11e-113PREDICTED: uncharacterized protein LOC4345661
TrEMBLA0A0D9X8640.0A0A0D9X864_9ORYZ; Uncharacterized protein
STRINGBGIOSGA028724-PA1e-131(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-73myb domain protein 105